Gene ML0776
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0776, len: 85 aa. Conserved hypothetical protein, highly similar to the N-terminal half of Rv3242c|MTCY20B11.17c|O05887 Conserved hypothetical protein from Mycobacterium tuberculosis (213 aa), fasta scores: E(): 6.8e-18, (78.1% identity in 64 aa); and CAD95362| from M. bovis (213 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 920259 | 920516 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0776|ML0776
VAGCGVFATRWSDACTAELSVAAGEPRVVSLCVDPLVPVVVLGRYVGARRQAILAMKEHGRRNLVALPTRQCVSRLGSCTLPGRG
Bibliography
No article yet recorded