Gene MLPM_1395
in Mycobacterium lepromatosis Mx1-22A
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50S ribosomal protein L35 |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 19552 | 19746 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium lepromatosis Mx1-22A|MLPM_1395|rpmI
MPKAKTHSGASKRFRRTSTGKIVRQKANRRHLFEHKPSTRTRRLDGRTRVAASDTQRVNSLLNG
Bibliography
- Singh P et al. [2015]. Insight into the evolution and origin of leprosy bacilli from the genome sequence of Mycobacterium lepromatosis. Sequence