Gene ML1395
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable 50S ribosomal protein L35 RpmI |
Comments | ML1395, len: 64 aa. Probable rpmI, 50S ribosomal protein L35. Highly similar to many 50s ribosomal L35 proteins, including: Escherichia coli SW:RL35_ECOLI (P07085) (64 aa), Fasta scores: E(): 2.3e-05, 43.4% identity in 53 aa overlap and Mycobacterium tuberculosis Rv1642 SW:RL35_MYCTU (P94976) (64 aa), Fasta scores: E(): 1.6e-24, 90.6% identity in 64 aa overlap. Contains Pfam match to entry PF01632 Ribosomal_L35p, Ribosomal protein L35. Belongs to the L35P family of ribosomal proteins. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1676419 | 1676613 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1395|rpmI MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLFEHKPSTRTRRLDGHTRVSANDTQRVNSLLNG
Bibliography
No article yet recorded