Gene MMAR_0347
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | has an important function as a repair enzyme for proteins that have been inactivated by oxidation. catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine [catalytic activity: protein L-methionine + oxidized thioredoxin = protein L-methionine S-oxide + reduced thioredoxin]. |
| Product | peptide methionine sulfoxide reductase MsrA |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 398166 | 398681 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_0347|msrA
MTSPQKAILAGGCFWGMQDLIRKQPGVIATRVGYSGGDVANATYRNHGTHAEAVEIIFDPQATDYRTLLEFFFQIHDPTTPNRQGNDRGTSYRSAIYYLDDEQKRVALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPSGYTCHFIRPGWKLPRRATAGQ
Bibliography
No article yet recorded