Gene Rv0137c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine [catalytic activity: protein L-methionine + oxidized thioredoxin + H2O = protein-L-methionine-(S)-S-oxide + reduced thioredoxin]. |
| Product | Probable peptide methionine sulfoxide reductase MsrA (protein-methionine-S-oxide reductase) (peptide met(O) reductase) |
| Comments | Rv0137c, (MTCI5.11c), len: 182 aa. Probable msrA, peptide methionine sulfoxide reductase (See St. John et al., 2001), equivalent to CAC32179.1|AL583926 putative peptide methionine sulfoxide from Mycobacterium leprae (177 aa). Highly similar to others e.g. CAC18703.1|AL451182 putative peptide methionine sulfoxide reductase from Streptomyces coelicolor (172 aa); PMSR_SCHPO|Q09859 putative peptide methionine sulfoxide reductase from Streptomyces (187 aa), FASTA scores: opt: 468, E(): 9.9e-26, (45.6% identity in 158 aa overlap); etc. Belongs to the MsrA family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 164712 | 165260 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0137c|msrA
MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRLPRRTAESALRASLSPELGT
Bibliography
- St John G, Brot N, Ruan J, Erdjument-Bromage H, Tempst P, Weissbach H and Nathan C [2001]. Peptide methionine sulfoxide reductase from Escherichia coli and Mycobacterium tuberculosis protects bacteria against oxidative damage from reactive nitrogen intermediates. Function Product
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Taylor AB, Benglis Jr DM, Dhandayuthapani S and Hart PJ [2003]. Structure of Mycobacterium tuberculosis methionine sulfoxide reductase A in complex with protein-bound methionine. Product Structure
- Lee WL et al. [2009]. Mycobacterium tuberculosis expresses methionine sulphoxide reductases A and B that protect from killing by nitrite and hypochlorite. Function Mutant Product
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
