Gene MMAR_1152
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in purine salvage. catalyzes the hydrolysis of all of the commonly occurring purine and pyrimidine nucleosides into ribose and the associated base, and could have a preference for inosine and uridine as substrates [catalytic activity: a N-D-ribosylpurine + H(2)O = a purine + d- ribose]. |
| Product | inosine-uridine nucleoside hydrolase, IunH |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1382851 | 1383801 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1152|iunH
VNPVFVDADTGIDDALALIYLLASTDADLVGIASTGGNTSVDQVCTNNLGVLELCRAGDIPVARGADQPLTGQWPHRANTHGPKGLGYAELPPTNRELATYDAAAAWVRMAHAYRGKLTGLVTGPLTNLARALRAEPALPAMLSRLVIMGGMFDADGNDVGADWNIRVDPEAASEVFAAWTGQQRLPIVCSLNLTRKVAMTPDILARLTCAAGPSALTRVIQDAVRFYFESHRDRGFGYLAYLHDPLAAAIALDPQLVTTQVATVDVVLADIPTRGMTVADRSGKHPPNARIGVSVDPAVFFERFIQRVAAFARRA
Bibliography
No article yet recorded