Gene MMAR_1612
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in transport of multidrugs (tetraphenylphosphonium, erythromycin, ethidium bromide, acriflavine, safranin O, pyronin Y, etc) across the membrane (export): multidrugs resistance by an export mechanism (conferes resistance to toxic compounds by removing them for the cells). responsible for the translocation of the substrate across the membrane. |
| Product | multidrug-transport integral membrane protein Mmr |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1949997 | 1950320 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1612|mmr
MAYLLLLGAIAMEVMATSFLKSTEGFTRLWPTVICLTVYGFSFAMLAMSIARGMQTDVAYALWSAIGTGAIVLIAVLFLGSHLSLTKVLGVGLIIGGVLTLNLTGAH
Bibliography
No article yet recorded