Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transport of multidrugs (tetraphenylphosphonium, erythromycin, ethidium bromide, acriflavine, safranin O, pyronin Y, etc) across the membrane (export): multidrugs resistance by an export mechanism (conferes resistance to toxic compounds by removing them for the cells). Responsible for the translocation of the substrate across the membrane.
ProductMultidrugs-transport integral membrane protein Mmr
CommentsRv3065, (MT3150.1, MTCY22D7.17c), len: 107 aa. Mmr, integral membrane multidrugs resistance transporter (see citation below), equivalent to Q9CBP1|ML1756 probable multidrug resistance protein from Mycobacterium leprae (107 aa), FASTA scores: opt: 534, E(): 3.3e-28, (77.55% identity in 107 aa overlap). Also highly similar to bacterial proteins involved in resistance to ethidium bromide or methyl viologen e.g. O87866|QACG_STASP quaternary ammonium compound-resistance protein QACG (quarternary ammonium determinant G) from Staphylococcus sp. strain ST94 (107 aa), FASTA scores: opt: 307, E(): 1.8e-13, (39.8% identity in 103 aa overlap); P96460|QAC quaternary ammonium compounds resistance protein QAC from Staphylococcus aureus (107 aa), FASTA scores: opt: 304, E(): 2.8e-13, (40.4% identity in 104 aa overlap); Q57225|QACE_ECOLI quaternary ammonium compound-resistance protein QACE (quarternary ammonium determinant E) from Escherichia coli (110 aa), FASTA scores: opt: 300, E(): 5.2e-13, (48.15% identity in 108 aa overlap); AAG55967|Z1870 methylviologen resistance protein encoded within prophage CP-933X from Escherichia coli strain O157:H7 EDL933 (110 aa); P23895|EMRE|MVRC|EB|B0543 EMRE protein from Escherichia coli (110 aa), FASTA scores: opt: 290, E(): 2.3e-12, (43.55% identity in 101 aa overlap); etc. Also similar to the SugE protein of enteric bacteria. Belongs to the small multidrug resistance (SMR) protein family. Note that previously known as emrE.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34303873430710+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3065|mmr
LIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH