Gene MMAR_1701
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | component of the translational apparatus. furnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated glu- tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. the reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-glu-tRNA(Gln) [catalytic activity: ATP + L-glutamyl-tRNA(Gln) + L-glutamine = ADP + phosphate + L-glutaminyl-tRNA(Gln) + L-glutamate]. |
| Product | glutamyl-tRNA(Gln) amidotransferase (subunit C) GatC |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2050154 | 2050453 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1701|gatC
VSQISRDEVAHLARLARLALTEDELDSFAGQLDAILTHVSQIQAVDVTGVEATDNPLKDVNVMRADQTAPCLTQEEALAEAPAAVDGRFAVPQILGDSE
Bibliography
No article yet recorded