Gene Rv3012c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Component of the translational apparatus. Furnishes a means for formation of correctly charged GLN-tRNA(GLN) through the transamidation of misacylated GLU- tRNA(GLN) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-GLU-tRNA(GLN) [catalytic activity: ATP + L-glutamyl-tRNA(GLN) + L-glutamine = ADP + phosphate + L-glutaminyl-tRNA(GLN) + L-glutamate]. |
| Product | Probable glutamyl-tRNA(GLN) amidotransferase (subunit C) GatC (Glu-ADT subunit C) |
| Comments | Rv3012c, (MT3092, MTV012.26c), len: 99 aa. Probable gatC, Glu-tRNA-Gln amidotransferase, subunit C, equivalent to O33104|GATC_MYCLE|MLCB637.12 glutamyl-tRNA(GLN) amidotransferase from Mycobacterium leprae (99 aa), FASTA scores: opt: 483, E(): 3.1e-25, (74.75% identity in 99 aa overlap). Also highly similar to other Glu-tRNA-Gln amidotransferases e.g. Q9Z581|GATC_STRCO|SC8D9.10 from Streptomyces coelicolor (98 aa), FASTA scores: opt: 298, E(): 4e-13, (53.7% identity in 95 aa overlap); O06492|GATC_BACSU from B. subtilis (96 aa), FASTA scores: opt: 222, E(): 3.7e-08, (43.15% identity in 95 aa overlap); Q9KF29|BH0665 from Bacillus halodurans (96 aa), FASTA scores: opt: 211, E(): 1.9e-07, (41.05% identity in 95 aa overlap); etc. For more information about function, see citation below. Belongs to the GatC family. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3371431 | 3371730 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3012c|gatC
VSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ
Bibliography
- Curnow AW et al. [1997]. Glu-tRNAGln amidotransferase: a novel heterotrimeric enzyme required for correct decoding of glutamine codons during translation. Homolog Product Function Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
