Gene MMAR_1760
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | responsible for the direct conversion of chorismate to p-hydroxybenzoate, the substrate used in the production of glycosylated p-hydroxybenzoic acid methyl esters and structurally related phenolphthiocerol glycolipids. in M. tuberculosis, this is the sole enzymatic source of p-hydroxybenzoic acid. |
| Product | chorismate pyruvate-lyase |
| Comments | - |
| Functional category | Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2116910 | 2117548 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1760|MMAR_1760
MLAALPEKQEMTECHLSDEDIRKLNRDLRILIATNGTLTRILNVLANDEIVVEIVKQQIQDAAPEMDGCDHSSIGRVLRRDIVLKGRRSGIPFVAAESFIAIDLLPPEIVASLLETHRPIGEVMAASCIETFKEEAKVWAGESPAWLALDRRRNLPPKVVGRQYRVIAEGRPVIIITEYFLRSVFEDNSREEPIRHQRSVGTSARSGRSICT
Bibliography
No article yet recorded