Gene MMAR_1769
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | probably involved in active transport of phthiocerol dimycocerosate (dim) across the membrane (export). DrrA, DrrB and DrrC may act jointly to confer daunorubicin and doxorubicin resistance by an export mechanism. probably responsible for the translocation of the substrate across the membrane and localization of dim into the cell wall. |
| Product | daunorubicin-DIM-transport integral membrane protein ABC transporter DrrC |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2141334 | 2142155 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1769|drrC
MTSQEIAFAPAQSQHTDHSARLLIWQTLVQTQRILTRWSRDFVTLIEALVFPILFMLVLKIVLGNLIYAVTHHDAMYSIVPLIALGAAITGSAFVAIDLMRERTSGLLSRLWVLPVHRMSGLMARILADAVRILFTTLVMLGVGILMGFEFRQGLIASLMWLCVPVTLGIAFAVMVTTVALYSSQAVIVEGVELTQAIAIFFSTGLIPLDQYPHWIQPVVAHQPVSYAVSAMRGLSMGGPVLLPMIGVLLWTAGICAVCAVPLAVGWRRASTH
Bibliography
No article yet recorded