Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionProbably involved in active transport of antibiotic and phthiocerol dimycocerosate (dim) across the membrane (export). DRRA|Rv2934|MTCY19H9.04, DRRB|Rv2937|MTCY19H9.05 and DRRC may act jointly to confer daunorubicin and doxorubicin resistance by an export mechanism. Probably responsible for the translocation of the substrate across the membrane and localization of dim into the cell wall.
ProductProbable daunorubicin-dim-transport integral membrane protein ABC transporter DrrC
CommentsRv2938, (MTCY19H9.06), len: 276 aa. Probable drrC, daunorubicin-dim-transport integral membrane protein ABC transporter, probably involved in daunorubicin resistance and phthiocerol dimycocerosate transport (see citations below), equivalent to Q9CB71|ML2350 probable antibiotic resistance membrane protein from Mycobacterium leprae (276 aa), FASTA scores: opt: 1434, E(): 1.2e-81, (79.0% identity in 276 aa overlap); and Q49941|DRRC|L518_F3_76 putative daunorubicin resistance transmembrane protein from Mycobacterium leprae (244 aa), FASTA scores: opt: 1194, E(): 8.3e-67, (76.85% identity in 242 aa overlap). Also similar to others e.g. Q9XCF9 DRRC protein from Mycobacterium avium (263 aa), FASTA scores: opt: 538, E(): 3.7e-26, (32.65% identity in 251 aa overlap); Q9S6H3 daunorubicin resistance protein C from Mycobacterium avium (263 aa), FASTA scores: opt: 533, E(): 7.6e-26, (32.25% identity in 251 aa overlap); P32011|DRRB_STRPE daunorubicin resistance transmembrane protein from Streptomyces peucetius (283 aa), FASTA scores: opt: 276, E(): 6.6e-10, (21.07% identity in 261 aa overlap); etc. Note that Rv2938|drrC belongs to the transcriptional unit Rv2930|fadD26-Rv2939|papA5 (proven experimentally).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32740723274902+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2938|drrC
MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMVVLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVHRASGLISRILANAIRTLVTTLVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVTTVALYTAQTVVVEGVELVQAIAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAMGGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH
      
Bibliography