Gene Rv2938
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Probably involved in active transport of antibiotic and phthiocerol dimycocerosate (dim) across the membrane (export). DRRA|Rv2934|MTCY19H9.04, DRRB|Rv2937|MTCY19H9.05 and DRRC may act jointly to confer daunorubicin and doxorubicin resistance by an export mechanism. Probably responsible for the translocation of the substrate across the membrane and localization of dim into the cell wall. |
| Product | Probable daunorubicin-dim-transport integral membrane protein ABC transporter DrrC |
| Comments | Rv2938, (MTCY19H9.06), len: 276 aa. Probable drrC, daunorubicin-dim-transport integral membrane protein ABC transporter, probably involved in daunorubicin resistance and phthiocerol dimycocerosate transport (see citations below), equivalent to Q9CB71|ML2350 probable antibiotic resistance membrane protein from Mycobacterium leprae (276 aa), FASTA scores: opt: 1434, E(): 1.2e-81, (79.0% identity in 276 aa overlap); and Q49941|DRRC|L518_F3_76 putative daunorubicin resistance transmembrane protein from Mycobacterium leprae (244 aa), FASTA scores: opt: 1194, E(): 8.3e-67, (76.85% identity in 242 aa overlap). Also similar to others e.g. Q9XCF9 DRRC protein from Mycobacterium avium (263 aa), FASTA scores: opt: 538, E(): 3.7e-26, (32.65% identity in 251 aa overlap); Q9S6H3 daunorubicin resistance protein C from Mycobacterium avium (263 aa), FASTA scores: opt: 533, E(): 7.6e-26, (32.25% identity in 251 aa overlap); P32011|DRRB_STRPE daunorubicin resistance transmembrane protein from Streptomyces peucetius (283 aa), FASTA scores: opt: 276, E(): 6.6e-10, (21.07% identity in 261 aa overlap); etc. Note that Rv2938|drrC belongs to the transcriptional unit Rv2930|fadD26-Rv2939|papA5 (proven experimentally). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3274072 | 3274902 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2938|drrC
MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMVVLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVHRASGLISRILANAIRTLVTTLVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVTTVALYTAQTVVVEGVELVQAIAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAMGGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH
Bibliography
- Camacho LR, Ensergueix D, Perez E, Gicquel B and Guilhot C [1999]. Identification of a virulence gene cluster of Mycobacterium tuberculosis by signature-tagged transposon mutagenesis. Mutant
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Camacho LR et al. [2001]. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. Mutant Function
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
