Gene MMAR_1771
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | probably involved in active transport of antibiotic and phthiocerol dimycocerosate (dim) across the membrane (export). DrrA, DrrB and DrrC may act jointly to confer daunorubicin and doxorubicin resistance by an export mechanism. responsible for energy coupling to the transport system. |
| Product | daunorubicin-DIM-transport ATP-binding protein ABC transporter DrrA |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2143027 | 2144022 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1771|drrA
MRNNDLAVEVRGVRKAFGDVVALNDISFEVGRGEVIGLLGPNGAGKTTMVDILSTLTRPDAGSAHVAGSDVVAQPAGVRRSIMVTGQQVAVDDGLTGEQNLVLFGRLYGLRKSRARQRAQELLDQFGLTYAGKRLVRTYSGGMRRRIDIACGLVVEPQVAFLDEPTTGLDPRSRQAIWDLVTSFKKLGIATLLTTQYLEEADALSDRIILIDHGKIIADGTANELKHRAGDTFCEIVPRHLKDLDATVAALGSLLPEHNRAMVTSESDRITMPAPDGTRTLIEAARRIDEANIELADIALRRPSLDDVFLSMTTDPSEAHALSHVASGAML
Bibliography
No article yet recorded