Gene Rv2936
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Probably involved in active transport of antibiotic and phthiocerol dimycocerosate (dim) across the membrane (export). DRRA, DRRB|Rv2936|MTCY19H9.05 and DRRC|Rv2938|MTCY19H9.06 may act jointly to confer daunorubicin and doxorubicin resistance by an export mechanism. Responsible for energy coupling to the transport system. |
| Product | Daunorubicin-dim-transport ATP-binding protein ABC transporter DrrA |
| Comments | Rv2936, (MTCY19H9.04), len: 331 aa. drrA, daunorubicin-dim-transport resistance ATP-binding protein ABC transporter, probably involved in daunorubicin resistance and phthiocerol dimycocerosate transport (see citations below), equivalent to Q49938|DRRA|ML2352|L518_F2_43|DRRA probable daunorubicin resistance ATP-binding protein from Mycobacterium leprae (331 aa), FASTA scores: opt: 1842, E(): 4.2e-103, (85.2% identity in 331 aa overlap). Also highly similar to others e.g. Q9XCF7 DRRA from Mycobacterium avium (315 aa), FASTA scores: opt: 1040, E(): 4.7e-55, (54.35% identity in 309 aa overlap); Q9X5J8 daunorubicin resistance protein A from Mycobacterium avium (315 aa), FASTA scores: opt: 1030, E(): 1.9e-54, (53.7% identity in 309 aa overlap); P32010|DRRA_STRPE daunorubicin resistance ATP-binding protein from Streptomyces peucetius (330 aa), FASTA scores: opt: 852, E(): 9e-44, (47.15% identity in 318 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop), and PS00211 ABC transporters family signature. Belongs to the ATP-binding transport protein family (ABC transporters). Note that Rv2936|drrA belongs to the transcriptional unit Rv2930|fadD26-Rv2939|papA5 (proven experimentally). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). |
| Operon | Rv2935 and Rv2936, Rv2936 and Rv2937 are co-transcribed, by RT-PCR (see Roback et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3272214 | 3273209 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2936|drrA
MRNDDMAVVVNGVRKTYGKGKIVALDDVSFKVRRGEVIGLLGPNGAGKTTMVDILSTLTRPDAGSAIIAGYDVVSEPAGVRRSIMVTGQQVAVDDALSGEQNLVLFGRLWGLSKSAARKRAAELLEQFSLVHAGKRRVGTYSGGMRRRIDIACGLVVQPQVAFLDEPTTGLDPRSRQAIWDLVASFKKLGIATLLTTQYLEEADALSDRIILIDHGIIIAEGTANELKHRAGDTFCEIVPRDLKDLDAIVAALGSLLPEHHRAMLTPDSDRITMPAPDGIRMLVEAARRIDEARIELADIALRRPSLDHVFLAMTTDPTESLTHLVSGSAR
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Camacho LR et al. [2001]. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. Mutant Function
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Roback P et al. [2007]. A predicted operon map for Mycobacterium tuberculosis. Operon
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
