Gene MMAR_1788
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | in nitrogen-limiting conditions, when the ratio of Gln to 2-ketoglutarate decreases, P-II is uridylylated to P-II-UMP by GlnD. P-II-UMP allows the deadenylylation of glutamine synthetase (gs), thus activating the enzyme. converserly, in nitrogen excess P-II is deuridylated and promotes the adenylation of gs. P-II indirectly controls the transcription of the gs gene. P-II prevents NR-II catalyzed conversion of NR-I to NR-I-phosphate, the transcriptional activator of GlnA. when P-II is uridylylated to P-II-UMP, these events are reversed. |
| Product | nitrogen regulatory protein P-II GlnB |
| Comments | - |
| Functional category | Regulatory proteins |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2183882 | 2184220 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1788|glnB
MKLITAIVKPFTLDDVKTSLEEAGVLGMTVSEIQGYGRQKGHTEVYRGAEYSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGPDAL
Bibliography
No article yet recorded
