Gene Rv2919c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | In nitrogen-limiting conditions, when the ratio of GLN to 2-ketoglutarate decreases, P-II is uridylylated to P-II-UMP by GLND|Rv2918c. P-II-UMP allows the deadenylylation of glutamine synthetase (gs), thus activating the enzyme. Converserly, in nitrogen excess P-II is deuridylated and promotes the adenylation of gs. P-II indirectly controls the transcription of the gs gene (GLNA: four copies in the genome). P-II prevents NR-II catalyzed conversion of NR-I to NR-I-phosphate, the transcriptional activator of GLNA. When P-II is uridylylated to P-II-UMP, these events are reversed. |
| Product | Probable nitrogen regulatory protein P-II GlnB |
| Comments | Rv2919c, (MTCY338.08c), len: 112 aa. Probable glnB, nitrogen regulatory protein, highly similar to others e.g. Q9X705|GLNB PII protein from Corynebacterium glutamicum (Brevibacterium flavum) (112 aa), FASTA scores: opt: 531, E(): 4.5e-30, (68.75% identity in 112 aa overlap); P21193|GLNB_AZOBR nitrogen regulatory protein P-II from Azospirillum brasilense (112 aa), FASTA scores: opt: 496, E(): 1.2e-27, (60.7% identity in 112 aa overlap); P05826|GLNB_ECOLI|B2553|Z3829|ECS3419|STY2808 nitrogen regulatory protein P-II from Escherichia coli strains K12 and O157:H7 (112 aa), FASTA scores: opt: 487, E(): 5.3e-27, (61.6% identity in 112 aa overlap); etc. Contains PS00496 P-II protein urydylation site. Belongs to the P(II) protein family. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3230738 | 3231076 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2919c|glnB
MKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAEYSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDAL
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant