Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionIn nitrogen-limiting conditions, when the ratio of GLN to 2-ketoglutarate decreases, P-II is uridylylated to P-II-UMP by GLND|Rv2918c. P-II-UMP allows the deadenylylation of glutamine synthetase (gs), thus activating the enzyme. Converserly, in nitrogen excess P-II is deuridylated and promotes the adenylation of gs. P-II indirectly controls the transcription of the gs gene (GLNA: four copies in the genome). P-II prevents NR-II catalyzed conversion of NR-I to NR-I-phosphate, the transcriptional activator of GLNA. When P-II is uridylylated to P-II-UMP, these events are reversed.
ProductProbable nitrogen regulatory protein P-II GlnB
CommentsRv2919c, (MTCY338.08c), len: 112 aa. Probable glnB, nitrogen regulatory protein, highly similar to others e.g. Q9X705|GLNB PII protein from Corynebacterium glutamicum (Brevibacterium flavum) (112 aa), FASTA scores: opt: 531, E(): 4.5e-30, (68.75% identity in 112 aa overlap); P21193|GLNB_AZOBR nitrogen regulatory protein P-II from Azospirillum brasilense (112 aa), FASTA scores: opt: 496, E(): 1.2e-27, (60.7% identity in 112 aa overlap); P05826|GLNB_ECOLI|B2553|Z3829|ECS3419|STY2808 nitrogen regulatory protein P-II from Escherichia coli strains K12 and O157:H7 (112 aa), FASTA scores: opt: 487, E(): 5.3e-27, (61.6% identity in 112 aa overlap); etc. Contains PS00496 P-II protein urydylation site. Belongs to the P(II) protein family.
Functional categoryRegulatory proteins
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32307383231076-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2919c|glnB
MKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAEYSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDAL