Gene MMAR_1986
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | catalyzes the first step in the biosynthesis of 2-methylthio-n6-(delta(2)-isopentenyl)-adenosine adjacent to the anticodon of several tRNA species [catalytic activity: isopentenyl diphosphate + tRNA = pyrophosphate + tRNA containing 6-isopentenyladenosine]. |
| Product | tRNA delta(2)-isopentenylpyrophosphate transferase MiaA |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2405310 | 2406254 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1986|miaA
MRPLAIIGPTGSGKSQLALDVAERLAGEVPAEIVNADAMQLYRGMDIGTAKLSVAARRGIPHHQLDVLNVAETATVARYQQAAAADIEAIIARGHVPIVVGGSMLYVQSLLDNWSFPATDPAVRARWEECLAELGVGELHAELARRDPAAAATILPTDGRRIVRALEVIELTGQPFAASAPRIGAAQWGTAIIGLDCDTPILDDRLAVRTDSMFERGLVEEVRVLLRAGLRDGVTAARALGYAQVLAALDAGGGAELLDDAREQTYFGTRRYVRRQRSWFRRDHRVHWCDAGATGPSDRAAMVDEALRVWRHVT
Bibliography
No article yet recorded