Gene Rv2727c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Catalyzes the first step in the biosynthesis of 2-methylthio-N6-(delta(2)-isopentenyl)-adenosine (ms[2]I[6]a]) adjacent to the anticodon of several tRNA species [catalytic activity: isopentenyl diphosphate + tRNA = pyrophosphate + tRNA containing 6-isopentenyladenosine]. |
| Product | Probable tRNA delta(2)-isopentenylpyrophosphate transferase MiaA (IPP transferase) (isopentenyl-diphosphate:tRNA isopentenyltransferase) (iptase) (IPPT) |
| Comments | Rv2727c, (MTCY154.07c), len: 314 aa. Probable miaA, tRNA delta(2)-isopentenylpyrophosphate transferase, equivalent to P46811|MIAA_MYCLE|ML0995|B2235_C3_232 tRNA delta(2)-isopentenylpyrophosphate transferase from Mycobacterium leprae (311 aa), FASTA scores: opt: 1679, E(): 3.2e-89, (81.85% identity in 314 aa overlap). Also highly similar to many e.g. O69967|MIAA_STRCO|SC4H2.12 from Streptomyces coelicolor (312 aa), FASTA scores: opt: 1006, E(): 1.2e-50, (55.5% identity in 301 aa overlap); O31795|MIAA_BACSU from Bacillus subtilis (314 aa), FASTA scores: opt: 671, E(): 1.9e-31, (38.55% identity in 293 aa overlap);P16384|MIAA_ECOLI|TRPX|B4171 from Escherichia coli strain K12 and Shigella flexneri (316 aa), FASTA scores: opt: 565, E(): 2.3e-25, (35.2% identity in 307 aa overlap);etc. Contains PS00017 ATP/GTP-binding site motif A (P -loop). Belongs to the IPP transferase family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3039825 | 3040769 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2727c|miaA
VRPLAIIGPTGAGKSQLALDVAARLGARVSVEIVNADAMQLYRGMDIGTAKLPVSERRGIPHHQLDVLDVTETATVARYQRAAAADIEAIAARGAVPVVVGGSMLYVQSLLDDWSFPATDPSVRARWERRLAEVGVDRLHAELARRDPAAAAAILPTDARRTVRALEVVELTGQPFAASAPRIGAPRWDTVIVGLDCQTTILDERLARRTDLMFDQGLVEEVRTLLRNGLREGVTASRALGYAQVIAALDAGAGADMMRAAREQTYLGTRRYVRRQRSWFRRDHRVHWLDAGVASSPDRARLVDDAVRLWRHVT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
