Gene MMAR_2017
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in biosynthesis of thymidylate. this enzyme is involved in nucleotide metabolism: it produces dump, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA [catalytic activity: dUTP + H(2)O = dump + pyrophosphate]. |
| Product | deoxyuridine 5'-triphosphate nucleotidohydrolase DutT |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2435230 | 2435694 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2017|dut
VSNSLAVVRLDPGLPLPSRAHDGDAGVDLYSAEDVVLPPGQRALVRTGVAVAIPFGMVGLVHPRSGLASRVGLSIVNSPGTIDAGYRGELKVALINLDPATPIVVNRGDRIAQLLVQRVELLELVEVSSFDEAGLAATSRGDGGHGSSGGHASL
Bibliography
No article yet recorded