Gene Rv2697c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in biosynthesis of thymidylate. This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA [catalytic activity: dUTP + H(2)O = dUMP + pyrophosphate]. |
| Product | Probable deoxyuridine 5'-triphosphate nucleotidohydrolase Dut (dUTPase) (dUTP pyrophosphatase) (deoxyuridine 5'-triphosphatase) (dUTP diphosphatase) (deoxyuridine-triphosphatase) |
| Comments | Rv2697c, (MT2771, MTCY05A6.18c), len: 154 aa. Probable dut, deoxyuridine 5'-triphosphate nucleotidohydrolase (see citation below), equivalent to Q49992|DUT_MYCLE|ML1028 deoxyuridine 5'-triphosphate nucleotidohydrolase from Mycobacterium leprae (154 aa), FASTA scores: opt: 928, E(): 2.1e-51, (90.25% identity in 154 aa overlap). Also highly similar to others e.g. O54134|DUT_STRCO|SC2E9.09 from Streptomyces coelicolor (183 aa), FASTA scores: opt: 534, E(): 1.2e-26, (56.1% identity in 148 aa overlap); O66592|DUT_AQUAE|AQ_220 from Aquifex aeolicus (150 aa), FASTA scores: opt: 398, E(): 3.3e-18, (48.05% identity in 152 aa overlap); Q9X3X5|DUT_ZYMMO from Zymomonas mobilis (146 aa), FASTA scores: opt: 396, E(): 4.4e-18, (49.0% identity in 147 aa overlap); etc. Belongs to the dUTPase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3013683 | 3014147 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2697c|dut
VSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Chan S et al. [2004]. Crystal structure of the Mycobacterium tuberculosis dUTPase: insights into the catalytic mechanism. Structure
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant