Gene MMAR_2106
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2538447 | 2538878 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2106|MMAR_2106
VSRNRLFVIASALAVAALVAMVFGVSLLNRNIGSYIASHYQQESRDVNATRYLCEGSPKQVANTLSRYKSPAARASYGETEYLRYRHNIVSVGPAGTHPCIIKVENLSAGYNHGSYIFLGPGFYPGSPSGGSGGSPGGPGGSK
Bibliography
No article yet recorded