Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved membrane protein
CommentsRv2599, (MTCY227.02c), len: 143 aa. Probable conserved membrane protein, equivalent to Q9K536|2599 hypothetical 15.0 KDA protein (fragment) from Mycobacterium paratuberculosis (143 aa), FASTA scores: opt: 691, E(): 1.7e-33, (68.55% identity in 143 aa overlap). Shows weak similarity with Q9L089|SCC24.28c putative lipoprotein from Streptomyces coelicolor (131 aa), FASTA scores: opt: 130, E(): 0.52, (26.45% identity in 136 aa overlap). Contains PS00626 Regulator of chromosome condensation (RCC1) signature 2. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29274772927908+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2599|Rv2599
MSRNRLFLVAGSLAVAAAVSLISGITLLNRDVGSYIASHYRQESRDVNGTRYLCTGSPKQVATTLVKYQTPAARASHTDTEYLRYRNNIVTVGPDGTYPCIIRVENLSAGYNHGAYVFLGPGFTPGSPSGGSGGSPGGPGGSK