Gene MMAR_2215
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | modify the free amino group of the aminoacyl moiety of methionyl-tRNA(fMet). the formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by:(I) promoting its recognition by IF2 and (II) impairing its binding to EftU-GTP. [catalytic activity : 10-formyltetrahydrofolate + L-methionyl-tRNA + H(2)O = tetrahydrofolate + N-formylmethionyl-tRNA] |
| Product | methionyl-tRNA formyltransferase Fmt |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2664238 | 2665176 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2215|fmt
VRLVFAGTPETALPALHQLIDSPRHDVIAVLTRPDAASGRRGKPEPSPVARAALERDIPVLRPSRPNSAEFVAELSELAPQCCAVVAYGALLGDALLGVPPQGWVNLHFSLLPAWRGAAPVQAAIAAGDAVTGATTFQIEPSLDSGPVYGVVTETIRPTDTAGDLLGRLAVSGAELLSATLDGIAEGALTARPQPADGVTLAPKISVEQARVRWELPAPIIERRIRAVTPNPGAWTLIGDLRVKLGPVYLDAAVKPPGPLPPGAIQVDRKHVWVGTGSEPLRLGQVQPPGKKLMNAADWARGARLDPSVRAS
Bibliography
No article yet recorded