Gene MMAR_2387
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in biotin synthesis. biotin synthase with flavodoxin, s-adenosylmethionine, and possibly cysteine to catalyze the last step of the biotin biosynthetic pathway. the reaction consists of the introduction of a sulphur atom into dethiobiotin, thus requiring activation of C-H bonds. biotin (vitamin H) is a prosthetic group in enzymes catalysing carboxylation and transcarboxylation reactions. |
| Product | biotin synthase BioB |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2882538 | 2883587 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2387|bioB
VTQAATRPSNDAGQDGVTEPDILAVARQQVLERGEGLNQEQVLQVLQLSEDRLEELLALAHDVRMRWCGPEVEVEGIISLKTGGCPEDCHFCSQSGLFSSPVRSAWLDIPSLVEAAKQTAKSGATEFCIVAAVRGPDARLLSQVAAGIEAIRNEVEINVACSLGMLTAEQVEQLAAMGVHRYNHNLETARSYFTNVVTTHTWEERWQTLTMVRDAGMEVCCGGILGMGETLEQRAEFAANLAELDPDEVPLNFLNPRPGTPFGDLEVLPAGEALKAVGAFRLALPRTMLRFAGGREITLGDLGAKRGILGGINAVIVGNYLTTLGRPAEADLELLEDLQMPLKALNASL
Bibliography
No article yet recorded