Gene Rv1589
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in biotin synthesis. |
| Product | Probable biotin synthetase BioB |
| Comments | Rv1589, (MTCY336.15c), len: 349 aa. Probable bioB, biotin synthetase O06601. Highly similar to BIOB_MYCLE|P46715 BioB from Mycobacterium leprae (345 aa), FASTA results: opt: 1982, E(): 0, (86.5% identity in 349 aa overlap). Identical to AF041819|AF041819_9 bioB from Mycobacterium bovis BCG (349 aa). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1790284 | 1791333 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1589|bioB
VTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVLAVLQLPDDRLEELLALAHEVRMRWCGPEVEVEGIISLKTGGCPEDCHFCSQSGLFASPVRSAWLDIPSLVEAAKQTAKSGATEFCIVAAVRGPDERLMAQVAAGIEAIRNEVEINIACSLGMLTAEQVDQLAARGVHRYNHNLETARSFFANVVTTHTWEERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELGPDEVPLNFLNPRPGTPFADLEVMPVGDALKAVAAFRLALPRTMLRFAGGREITLGDLGAKRGILGGINAVIVGNYLTTLGRPAEADLELLDELQMPLKALNASL
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
