Gene MMAR_2400
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in inositol phosphate metabolism. it is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides. key enzyme of the phosphatidyl inositol signaling pathway [catalytic activity: inositol 1(or 4)-monophosphate + H(2)O = inositol + orthophosphate]. |
| Product | inositol-monophosphatase ImpA |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2895565 | 2896377 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2400|impA
MDLAARLVTLVEQASAILDAAVPRFLGGHRADSAVPKKGNDFATEVDLAIERQVVAALEAATGIGVHGEEFGGTDVDSPWVWVLDPVDGTFNYAAGSPMAAILLGLLHEGEPVAGLTWLPFIGERYTAVAGGPLLRNGLPQASLAPAKLSESLMGVGTFSADSRGRFPGRYRLAVLENLSRVSSRLRIHGSTGIDLVYVADGILGGAISFGGQVWDHAAGVAQVRAAGGTVTTLTGDPWTPTSRSVLAAAPGVHEEILEIVRKTGDPEDY
Bibliography
No article yet recorded