Gene Rv1604
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in inositol phosphate metabolism. It is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides. Key enzyme of the phosphatidyl inositol signaling pathway [catalytic activity: inositol 1(or 4)-monophosphate + H(2)O = inositol + orthophosphate]. |
| Product | Probable inositol-monophosphatase ImpA (imp) |
| Comments | Rv1604, (MTV046.02), len: 270 aa. Probable impA, inositol monophosphatase, similar to many e.g. AF0059|AF005905_2 inositol monophosphate phosphatase from Mycobacterium smegmatis (276 aa), FASTA scores: opt: 1241, E(): 0, (70.5% identity in 261 aa overlap). Also similar to Mycobacterium tuberculosis proteins Rv3137 and Rv2701c. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Colony morphology of M. tuberculosis H37Rv impA|Rv1604 deletion mutant is not different from wild-type; phosphatidylinositol mannosides (PIMs; by TLC) and mycothiol levels (by HPLC) are normal in the mutant (See Movahedzadeh et al., 2010). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1804039 | 1804851 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1604|impA
MHLDSLVAPLVEQASAILDAATALFLVGHRADSAVRKKGNDFATEVDLAIERQVVAALVAATGIEVHGEEFGGPAVDSRWVWVLDPIDGTINYAAGSPLAAILLGLLHDGVPVAGLTWMPFTDPRYTAVAGGPLIKNGVPQPPLADAELANVLVGVGTFSADSRGQFPGRYRLAVLEKLSRVSSRLRMHGSTGIDLVFVADGILGGAISFGGHVWDHAAGVALVRAAGGVVTDLAGQPWTPASRSALAGPPRVHAQILEILGSIGEPEDY
Bibliography
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Movahedzadeh F et al. [2010]. Inositol monophosphate phosphatase genes of Mycobacterium tuberculosis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
