Gene MMAR_2539
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | unknown, contains six NHL repeats. the NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies. it is about 40 residues long and resembles the wd repeat pfam00400. the repeats may have a catalytic activity, proteolysis of one menber has shown that the peptidyl-alpha-hydroxyglycine alpha-amidating lyase (pal) activity is localised to the repeats. one member interacts with the activation domain of tat. this interaction is mediated by the NHL repeats. |
| Product | conserved hypothetical protein |
| Comments | - |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3092729 | 3093754 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2539|MMAR_2539
MAETPESTTKPATVTSQPRYDRSGRLSQVLAWVGIIAGAVFIAAVIFFSATFLGWYSGGHYSWHRGGAAGQLSPRSSQQSAPSQTLRLKVELPFIGLYVHTGGVAVDTAGNVYVASGGNDRVLKLPAGSSTQVELPFTGLKSPMGVAVDTVGNVYVTDSFHNRVLKLPAGSSTQVELPFTGLHRPGGVAVDAAGNVYVTDFVDNRMLKLPAGSSTQVELPFTGLHFPMGVAVDSAGNVYVTNDDNNRVLKLPAGSTTQVELPFTGLHHPVAVAVDTAGNVYAADHDNNRVLKLPAGSSTQVELPFTGLTGPMGVAVDSAGNVYVTNHDNDEVLELPAPYAS
Bibliography
No article yet recorded