Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved membrane protein
CommentsRv3524, (MTCY03C7.32c), len: 343 aa. Probable conserved membrane protein, showing some similarity to C-terminal part of putative Mycobacterium tuberculosis proteins O05871|P95308|PKND_MYCTU|Rv0931c|MT0958|MTCY08C9.08 serine-threonine protein kinase PknD (664 aa) FASTA scores: opt: 727, E(): 8.3e-36, (45.3% identity in 298 aa overlap); O53893|Rv0980c|MTV044.08c PGRS-family protein (457 aa), FASTA scores: opt: 208, E(): 4.4e-05, (33.75% identity in 166 aa overlap); and O53891|Rv0978c|MTV044.06c PGRS-family protein (331 aa) FASTA scores: opt: 153, E(): 0.062, (30.75% identity in 117 aa overlap). Contains PS00237 G-protein coupled receptors signature.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39607553961786+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3524|Rv3524
MVKFTPDSQTSVLRAGKCSGTLSPSRSRLQRGSWPVDSERRRYGWPRNRRTLAITGAAVVVVVTLAAIGYLIFEPKISGSSTSRQAASPTTPSPPSQVVVPIDLWNPDGVTVDLADAVYVADSGHKRLLKLPAGSNTPTTLPFTDTIGPGGVAVNSNRDVYVIDEDSHHVLKLAAGIEPPVELPFGSLGDAHGLAVDRSDSVYVVDYDNAKVLKLPPGADTPTELPFVGLDHPYDVAVDGAGTVYVTDSGHNRVVALTAGSATPVHLPFADLSFPAGVTVDRDDSVYVADLNNNRVLKLAAGSNAQSQLPFTGLFSPTDVAVDNDGAVYVIDFYNRMLKLPTA