Gene Rv3524
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved membrane protein |
| Comments | Rv3524, (MTCY03C7.32c), len: 343 aa. Probable conserved membrane protein, showing some similarity to C-terminal part of putative Mycobacterium tuberculosis proteins O05871|P95308|PKND_MYCTU|Rv0931c|MT0958|MTCY08C9.08 serine-threonine protein kinase PknD (664 aa) FASTA scores: opt: 727, E(): 8.3e-36, (45.3% identity in 298 aa overlap); O53893|Rv0980c|MTV044.08c PGRS-family protein (457 aa), FASTA scores: opt: 208, E(): 4.4e-05, (33.75% identity in 166 aa overlap); and O53891|Rv0978c|MTV044.06c PGRS-family protein (331 aa) FASTA scores: opt: 153, E(): 0.062, (30.75% identity in 117 aa overlap). Contains PS00237 G-protein coupled receptors signature. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3960755 | 3961786 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3524|Rv3524
MVKFTPDSQTSVLRAGKCSGTLSPSRSRLQRGSWPVDSERRRYGWPRNRRTLAITGAAVVVVVTLAAIGYLIFEPKISGSSTSRQAASPTTPSPPSQVVVPIDLWNPDGVTVDLADAVYVADSGHKRLLKLPAGSNTPTTLPFTDTIGPGGVAVNSNRDVYVIDEDSHHVLKLAAGIEPPVELPFGSLGDAHGLAVDRSDSVYVVDYDNAKVLKLPPGADTPTELPFVGLDHPYDVAVDGAGTVYVTDSGHNRVVALTAGSATPVHLPFADLSFPAGVTVDRDDSVYVADLNNNRVLKLAAGSNAQSQLPFTGLFSPTDVAVDNDGAVYVIDFYNRMLKLPTA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
