Gene MMAR_3711
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in the sulfate activation pathway (at the third step) in the reductive branch of the cysteine biosynthetic pathway. reduces activated sulfate into sulfite [catalytic activity: 5-phosphoadenosine 3-phosphosulfate + reduced thioredoxin = phosphoadenosine phosphate + oxidized thioredoxin + sulfite]. |
| Product | 3'-phosphoadenosine 5'-phosphosulfate reductase CysH |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4571300 | 4572049 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_3711|cysH
MIETSNLTEAELRELAARGAAELEGASATELLQWTDETFGGANRAAGVAGVQTANYVVASNMQDAVLIDLASKVRPGVPVLFLDTGYHFAETIGSRDAVESVYDVQVLTITPEHTVAEQDKLLGKDLFARDPGECCRLRKVVPLRQALSNFSAWVTGLRRVEAPTRANAPVISFDEAFKLVKINPLAAWSDDEVQDYIVANNVLVNPLVDEGYPSIGCAPCTVKPAAGADPRSGRWQGLAKTECGLHAS
Bibliography
No article yet recorded