Gene MMAR_3834
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | N-terminus: could be generate serine and phosphate from phosphoserine; may catalyze the last step in the biosynthesis of serine from carbohydrates (the reaction mechanism could be proceed via the formation of a phosphoryl-enzyme intermediates) [catalytic activity 1: phosphoserine + H(2)O = serine + phosphate]. mid-section: involved in phospholipid biosynthesis (at the second step); converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position [catalytic activity 2: acyl-CoA + 1-acyl-SN-glycerol 3-phosphate = CoA + 1,2-diacyl-SN-glycerol 3-phosphate]. c-terminus: contains tola protein domain homology. may serve to anchor this protein in the cm. |
| Product | bifunctional transmembrane phospholipid biosynthesis enzyme PlsC |
| Comments | - |
| Functional category | Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4766742 | 4768697 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_3834|plsC
MSAAEEPGDGREQDKAAGDLRLPGSVAEIMASPAGPKVGAFFDLDGTLVAGFTAVILTQERLRRRDIGVGELLSMVQAGLNHTLGRIEFEQLINTASSALRGRQLVDLEEIGERLFAQRIESRIYPEMRELVRAHVARGHTVVLSSSALTIQVNPVARFLGIVNMLTNKFETNEDGLLTGGVVKPILWGPGKAAAVQRFAAEHDIDLKDSYFYADGDEDVALMYLVGNPRPTNPEGKMAAVAKRRGWPILKFNSRGGVGLRRQIRTLAGFSTMFPVAAGAVGIGLLTGNRRRGVNFFTSNFSQLLLATSGVHLNVVGKENLTAQRPAVFIFNHRNQVDPVIAGALVRDNWVGVGKKELQNDPIMGTLGKVLDGVFIDRDDPASAVETLHTVEERAKNGLSIVIAPEGTRLDTTEVGPFKKGPFRIAMAAGIPIVPIVIRNAEIVASRNSTTINPGTVDIAVFPPIPVDDWTLDTLPDRIAEVRQLYLDTLKDWPVDELPEVNLYAEEKAAKKAKAQLAKASAKETPAKKAPAKKAPAKKAAAKKETSAKKAPAKKAPAKKAAAKKAPAKKATAKKAPAKKAPAKKVPESAAAKAATPATDTELPAPKPVGEASNPTEIAPEPIAHDGDAQQLGAGRSDAAESSSSRPKGRP
Bibliography
No article yet recorded