Gene Rv2483c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | C-terminus: involved in phospholipid biosynthesis (at the second step); converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position [catalytic activity 2: acyl-CoA + 1-acyl-SN-glycerol 3-phosphate = CoA + 1,2-diacyl-SN-glycerol 3-phosphate]. N-terminus: could be generate serine and phosphate from phosphoserine; may catalyze the last step in the biosynthesis of serine from carbohydrates (the reaction mechanism could be proceed via the formation of a phosphoryl-enzyme intermediates) [catalytic activity 1: phosphoserine + H(2)O = serine + phosphate]. |
| Product | Possible transmembrane phospholipid biosynthesis bifunctional enzyme PlsC: putative L-3-phosphoserine phosphatase (O-phosphoserine phosphohydrolase) (PSP) (pspase) + 1-acyl-SN-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (lysophosphatidic acid acyltransferase) (LPAAT) |
| Comments | Rv2483c, (MTV008.39c), len: 580 aa. Possible plsC, a transmembrane phospholipid biosynthesis bifunctional enzyme, including L-3-phosphoserine phosphatase and 1-acyl-Sn-glycerol-3-phosphate acyltransferase , equivalent to Q9X7A9|PLSC|ML1245 putative acyltransferase from Mycobacterium leprae (579 aa), FASTA scores: opt: 2835, E(): 9.2e-153, (77.15% identity in 573 aa overlap). C-terminal end is similar to many 1-acyl-SN-glycerol-3-phosphate acyltransferases (lysophosphatidic acidacyltransferases) e.g. Q9SDQ2 from Limnanthes floccosa (281 aa), FASTA scores: opt: 378, E(): 3.1e-14, (30.0% identity in 230 aa overlap) and Q42868|PLSC_LIMAL from Limnanthes alba (White meadowfoam) (281 aa), FASTA scores: opt: 374, E(): 5.2e-14, (30.55% identity in 221 aa overlap); and the N-terminal end is similar to many SerB family proteins e.g. AAK44749|MT0526 from Mycobacterium tuberculosis strain CDC1551 (308 aa), FASTA scores: opt: 356, E(): 5.8e-13, (32.5% identity in 298 aa overlap) and Q49823|ML2424 from Mycobacterium leprae (300 aa), FASTA scores: opt: 346, E(): 2.1e-12, (32.0% identity in 278 aa overlap). So belongs to the 1-acyl-SN-glycerol-3-phosphate acyltransferase family and may belong to the SerB family. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2789280 | 2791022 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2483c|plsC
MSAADEQGEERATRKSAPDLRLPGSVAEILASPAGPKVGAFFDLDGTLVAGFTAVILTQERLRRRDMGVGELLGMVQAGLNHTLGRIEFEDLIGKAAAALAGRLLTDLEEIGERLFAQRIESRIYPEMRELVRAHVARGHTVVLSSSALTIQVGPVARFLGINNMLTNKFETNEDGILTGGVLKPILWCPGKATAVQRFAAEHDIDLKDSYFYADGDEDVALMYLVGNPRPTNPEGKMAAVAKRRGWPILKFNSRGGVGIRRQLRTLAGLSTIVPVAAGAVGIGVLTGSRRRGVNFFTSTFSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVIAGALVRDNWVGVGKKELASDPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNGLSIVIAPEGTRLDTTEVGSFKKGPFRIAMAAKIPIVPIVIRNAEIVASRNSTTINPGTVDVAVFPPIPVDDWTLDALPDRIAEVRQLYLDTLADWPVDGLPAVDLYAEQKAARKARAQVAKATAKRVPAKKAPAKSAANKGAAATKAATKKASPKAKPSESKIAGKDGEASASPSSSAKGRS
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant