Gene MMAR_3961
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | biosynthesis of fatty acids and lipids. transfers the 4'-phosphopantetheine moiety from coenzyme a to a ser of acyl-carrier protein. catalyzes the formation of holo-ACP, which mediates the transfer of acyl fatty-acid intermediates during the biosynthesis of fatty acids and lipids [catalytic activity: CoA + apo-[acyl-carrier protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier protein] ] |
| Product | phosphopantetheinyl transferase AcpS |
| Comments | - |
| Functional category | Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4879229 | 4879621 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_3961|acpS
MGIVGVGIDLVSIPDFAEQVDQPGTAFAATFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGEIAKHLADVTIHVSLTHEGDTAAAVAILETS
Bibliography
No article yet recorded