Gene Rv2523c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Biosynthesis of fatty acids and lipids. Transfers the 4'-phosphopantetheine moiety from coenzyme A to a SER of acyl-carrier protein. Catalyzes the formation of holo-ACP, which mediates the transfer of acyl fatty-acid intermediates during the biosynthesis of fatty acids and lipids [catalytic activity: CoA + APO-[acyl-carrier protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier protein] ]. |
| Product | holo-[acyl-carrier protein] synthase AcpS (holo-ACP synthase) (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase) |
| Comments | Rv2523c, (MT2599, MTV009.08c), len: 130 aa. AcpS, holo-[Acyl Carrier Protein] synthase (see citation below), equivalent to Q9X7E3|ACPS_MYCLE|ML1192|MLCB458.07 holo-[acyl-carrier protein] synthase from Mycobacterium leprae (130 aa), FASTA scores: opt: 732, E(): 5.5e-42, (87.5% identity in 128 aa overlap). Also similar to others e.g. O86785|ACPS_STRCO|SC6G4.22c from Streptomyces coelicolor (123 aa), FASTA scores: opt: 204, E(): 6.6e-07, (36.7% identity in 139 aa overlap); Q9KPB6|VC2457 from Vibrio cholerae (126 aa), FASTA scores: opt: 163, E(): 0.00036, (32.55% identity in 129 aa overlap); P24224|ACPS_ECOLI|DPJ|B2563 from Escherichia coli strain K12 (125 aa), FASTA scores: opt: 151, E(): 0.0022, (30.55% identity in 131 aa overlap); etc. Belongs to the ACPS family. Acts on fas-I enzymes in C. glutamicum (See Chalut et al., 2006). |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene in M. smegmatis; C. glutamicum mutant is auxotrophic for oleic acid and produces only one detectable corynomycolate (See Chalut et al., 2006). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2839538 | 2839930 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2523c|acpS
MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTIHVSLTHEGDTAAAVAILEAP
Bibliography
- Chopra S et al. [2002]. Expression, purification, crystallization and preliminary X-ray analysis of the acyl carrier protein synthase (acpS) from Mycobacterium tuberculosis. Product Structure
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Joseph-McCarthy D et al. [2005]. Use of structure-based drug design approaches to obtain novel anthranilic acid acyl carrier protein synthase inhibitors. Biochemistry
- Chalut C et al. [2006]. The nonredundant roles of two 4'-phosphopantetheinyl transferases in vital processes of Mycobacteria. Biochemistry Mutant
- Dym O et al. [2009]. Structure-function analysis of the acyl carrier protein synthase (AcpS) from Mycobacterium tuberculosis. Structure
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
