Gene MMAR_4082 
in Mycobacterium marinum M
General annotation
      | Type | CDS | 
| Function | repair of alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. this is a suicide reaction: the enzyme is irreversibly inactivated [catalytic activity : DNA (containing 6-O-methylguanine) + [protein]-L-cysteine = DNA (without 6-O-methylguanine) + protein S-methyl-L-cysteine.] | 
| Product | methylated-DNA--protein-cysteine methyltransferase Ogt | 
| Comments | - | 
| Functional category | Information pathways | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 5029777 | 5030295 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium marinum M|MMAR_4082|ogt
MTHYRIVDSPIGPLTLAGHDGVLTNLRMVDQTYEPSRVGWEVDDEAFADAVSQLDAYFAGERFDFDLALDLRGTEFQRRVWRALLTIPYGETRSYGEIAERIGARGAARAVGLANGRNPVAVIVPCHRVIGASGGLTGYGGGLDRKQALLELERACVPADLTVRADLTLFDC
      
    Bibliography
    No article yet recorded