Gene MMAR_4082
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | repair of alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. this is a suicide reaction: the enzyme is irreversibly inactivated [catalytic activity : DNA (containing 6-O-methylguanine) + [protein]-L-cysteine = DNA (without 6-O-methylguanine) + protein S-methyl-L-cysteine.] |
| Product | methylated-DNA--protein-cysteine methyltransferase Ogt |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5029777 | 5030295 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_4082|ogt
MTHYRIVDSPIGPLTLAGHDGVLTNLRMVDQTYEPSRVGWEVDDEAFADAVSQLDAYFAGERFDFDLALDLRGTEFQRRVWRALLTIPYGETRSYGEIAERIGARGAARAVGLANGRNPVAVIVPCHRVIGASGGLTGYGGGLDRKQALLELERACVPADLTVRADLTLFDC
Bibliography
No article yet recorded