Gene Rv1316c (adaB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Repair of alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated [catalytic activity: DNA (containing 6-O-methylguanine) + [protein]-L-cysteine = DNA (without 6-O-methylguanine) + protein S-methyl-L-cysteine.] |
| Product | Methylated-DNA--protein-cysteine methyltransferase Ogt (6-O-methylguanine-DNA methyltransferase) (O-6-methylguanine-DNA-alkyltransferase) |
| Comments | Rv1316c, (MTCY130.01c), len: 165 aa. Ogt, methylated-dna--protein-cysteine methytransferase (see citation below), similar to many e.g. OGT_HAEIN|P44687 Haemophilus influenzae (190 aa), FASTA scores: opt: 405, E(): 6.5e-20, (41.9% identity in 155 aa overlap). Contains PS00374 Methylated-DNA--protein-cysteine methyltransferase active site. |
| Functional category | Information pathways |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Two different M. tuberculosis H37Rv Rv1316c-Rv1317c deletion mutants (SID-H, and BS-SK which lacks an additional 246 bp of Rv1316c) have normal in vitro growth; both mutants are ~100-fold more sensitive to the cytotoxic effects of N-methyl-N'-nitro-N-nitroguanidine (MNNG); SID-H mutant shows ~100-fold higher mutation rate leading to rifampin resistance with MNNG treatment than wild-type; growth of mutants in mice (SID-H in C57BL/6, BS-SK in BALB/c) is comparable to wild-type (See Durbach et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1477134 | 1477631 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1316c|ogt
MIHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Durbach SI et al. [2003]. DNA alkylation damage as a sensor of nitrosative stress in Mycobacterium tuberculosis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Yang M et al. [2011]. The ada operon of Mycobacterium tuberculosis encodes two DNA methyltransferases for inducible repair of DNA alkylation damage. Function Product
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant