Gene MMAR_4358
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides [catalytic activity: exonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield 5'-phosphomononucleotides] |
| Product | exodeoxyribonuclease vii (small subunit) XseB |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5364679 | 5364927 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_4358|xseB
MELDDHNGETDSVTPISQLGYEACRDELIEVVRLLEQGGLDLDTSLKLWERGEVLAKRCEEHLAGARQRVADALAASEAEQD
Bibliography
No article yet recorded