Gene Rv1107c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides [catalytic activity: exonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield 5'-phosphomononucleotides.] |
| Product | Probable exodeoxyribonuclease VII (small subunit) XseB (exonuclease VII small subunit) |
| Comments | Rv1107c, (MTV017.60c), len: 85 aa. Probable xseB, exonuclease VII small subunit (see citation below). Equivalent to AL049491|MLCB1222_6 Mycobacterium leprae (87 aa) (77.9% identity in 68 aa overlap). Similar to P43914|EX7S_HAEIN exodeoxyribonuclease small subunit from H. influenzae (84 aa), FASTA scores: opt: 126, E(): 0.006, (37.3% identity in 67 aa overlap); and P22938|EX7S_ECOLI exodeoxyribonuclease small subunit from Escherichia coli (79 aa), FASTA scores: opt: 125, E(): 0.0067, (39.7% identity in 58 aa overlap). Belongs to the XseB family. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1233966 | 1234223 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1107c|xseB
MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGARQRVSDVLAGDEAQNG
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
