Gene MMAR_4387 
in Mycobacterium marinum M
General annotation
      | Type | CDS | 
| Function | necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. the arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. cleavage of the nascent trancript by cleavage factors such as GreA or Greb allows the resumption of elongation from the new 3'terminus. GreA releases sequences of 2 to 3 nucleotides | 
| Product | transcription elongation factor GreA | 
| Comments | - | 
| Functional category | Information pathways | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 5395065 | 5395559 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium marinum M|MMAR_4387|greA
MTDTQVTWLTQESHDRLKAELDHLIANRPIIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDLLNNAKVGEAPKQSGIALPGSVVKVYYNGDQSDSETFLIATRQEGVNDGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGSVIEVTLISAEPYHS
      
    Bibliography
    No article yet recorded