Gene MMAR_4387
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. the arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. cleavage of the nascent trancript by cleavage factors such as GreA or Greb allows the resumption of elongation from the new 3'terminus. GreA releases sequences of 2 to 3 nucleotides |
| Product | transcription elongation factor GreA |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5395065 | 5395559 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_4387|greA
MTDTQVTWLTQESHDRLKAELDHLIANRPIIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDLLNNAKVGEAPKQSGIALPGSVVKVYYNGDQSDSETFLIATRQEGVNDGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGSVIEVTLISAEPYHS
Bibliography
No article yet recorded