Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionNecessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent trancript by cleavage factors such as GREA or GREB allows the resumption of elongation from the new 3'terminus. GREA releases sequences of 2 to 3 nucleotides
ProductProbable transcription elongation factor GreA (transcript cleavage factor GreA)
CommentsRv1080c, (MTV017.33c), len: 164 aa. Probable greA, transcription elongation factor G, closest to P46808|GREA_MYCLE transcription elongation factor G from Mycobacterium leprae (202 aa), FASTA scores: opt: 1005, E(): 0, (94.5% identity in 164 aa overlap); and similar to many e.g. P21346|GREA_ECOLI from Escherichia coli (158 aa), FASTA scores: opt: 257, E(): 5.7e-10, (37.2% identity in 148 aa overlap); etc. Contains two PS00829 and one PS00830 Prokaryotic transcription elongation factors signatures 1 and 2, respectively. Belongs to the GREA/GREB family.
Functional categoryInformation pathways
ProteomicsThe product of this CDS corresponds to spots 5_67 and 5_55 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS12053041205798-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1080c|greA
MTDTQVTWLTQESHDRLKAELDQLIANRPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDLLSNAKVGEAPKQSGVALPGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGSTVSVTLVSAEPYHS
      
Bibliography