Gene MMAR_4477 
in Mycobacterium marinum M
General annotation
      | Type | CDS | 
| Function | thought to be involved in deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis (at the fourth step). catalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol [catalytic activity: ATP + 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol = ADP + 2-phospho-4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol]. | 
| Product | 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE | 
| Comments | - | 
| Functional category | Intermediary metabolism and respiration | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 5499211 | 5500134 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium marinum M|MMAR_4477|ispE
VPTGSATVRVPGKVNLYLAVGDRRDDGYHELTTVFHAVSLVDEVTVRNADLLSLEVVGEGADRLPTDKRNLAWQAAELMAEHVGRAPDVSIFIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNLPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFARSGLSTPAVFTELDRLRDVGSPPRLAEPGPVLAALAAGDPEQLAPLLGNEMQAAAVSLDPALRRALRAGVEAGALAGIVSGSGPTCAFLCRTAESALDVSAQLSGAGVCRTVRIATGPVPGARVVPTPGIAE
      
    Bibliography
    No article yet recorded