Gene MMAR_4477
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | thought to be involved in deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis (at the fourth step). catalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol [catalytic activity: ATP + 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol = ADP + 2-phospho-4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol]. |
| Product | 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5499211 | 5500134 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_4477|ispE
VPTGSATVRVPGKVNLYLAVGDRRDDGYHELTTVFHAVSLVDEVTVRNADLLSLEVVGEGADRLPTDKRNLAWQAAELMAEHVGRAPDVSIFIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNLPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFARSGLSTPAVFTELDRLRDVGSPPRLAEPGPVLAALAAGDPEQLAPLLGNEMQAAAVSLDPALRRALRAGVEAGALAGIVSGSGPTCAFLCRTAESALDVSAQLSGAGVCRTVRIATGPVPGARVVPTPGIAE
Bibliography
No article yet recorded