Gene MMAR_4666
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | possibly a molybdenum biosynthesis cofactor. conversion of molybdopterin precursor Z into molybdopterin requires transfer of two sulfur atoms to precursor Z (to generate the dithiolene group). this is catalyzed by the converting factor composed of a small and large subunit. |
| Product | molybdenum cofactor biosynthesis protein E2 MoaE2 |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5719068 | 5719493 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_4666|moaE2
MTQVVRALLTDQPISLAEHEELVGRPSAGAVVGFVGVVRNHDGGREVLRLEYSAHPSAGQVLAEVVADVAQHAAGVRAVAASHRIGVLHVGDAALVAAVAADHREAAFTTCAKLVDTIKARLPVWKHQFFGDGSEEWVGSA
Bibliography
No article yet recorded