Gene Rv0866
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly a molybdenum biosynthesis cofactor. Conversion of molybdopterin precursor Z into molybdopterin requires transfer of two sulfur atoms to precursor Z (to generate the dithiolene group). This is catalyzed by the converting factor composed of a small and large subunit. |
| Product | Probable molybdenum cofactor biosynthesis protein E2 MoaE2 (molybdopterin converting factor large subunit) (molybdopterin [MPT] converting factor, subunit 2) |
| Comments | Rv0866, (MTV043.59), len: 141 aa. Probable moaE2, molybdopterin converting factor E (molybdopterin converting factor (subunit 2)), similar to others e.g. Y10817|ANY10817_4|T44853 molybdopterin biosynthesis protein E chain from Arthrobacter nicotinovorans plasmid pAO1 (155 aa), FASTA scores: opt: 460, E(): 3.5e-27, (49.3 identity in 146 aa overlap); CAC01331.1|AL390968 moaE-like protein from Streptomyces coelicolor (152 aa); NP_389313.1|NC_000964 molybdopterin converting factor (subunit 2) from Bacillus subtilis (157 aa); etc. Also highly similar to Rv3119|MOAE1|Z95150|MTCY164_30 putative molybdenum cofactor biosynthesis protein E from Mycobacterium tuberculosis (147 aa), FASTA scores: opt: 321, E(): 5.9e-17, (40.9% identity in 132 aa overlap); and O53375|GPHA|Rv3323c|MTV016.23c MOAD-MOAE fusion protein from Mycobacterium tuberculosis (221 aa). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 963869 | 964294 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0866|moaE2
MTQVLRAALTDQPIFLAEHEELVSHRSAGAIVGFVGMIRDRDGGRGVLRLEYSAHPSAAQVLADLVAEVAEESSGVRAVAASHRIGVLQVGEAALVAAVAADHRRAAFGTCAHLVETIKARLPVWKHQFFEDGTDEWVGSV
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
