Gene MMAR_4920
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | besides the cephalosporin acylase I activity which converts GL-7ACA into 7-Aca; this enzyme displays some gamma glutamyltranspeptidase activity: Ggt plays a key role in the gamma-glutamyl cycle, a pathway for the synthesis and degradation of glutathione. [catalytic activity 1: 7-beta-(4-carboxybutanamido)-cephalosporanic acid + H2O = 7-aminocephalosporanic acid + glutaric acid] [catalytic activity 2: (5-L-glutamyl)-peptide + an amino acid = peptide + 5-L-glutamyl-amino acid]. |
| Product | bifunctional acylase, GgtA |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5976939 | 5978540 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_4920|ggtA
VTSSAGSASPFGWTFPYAWPHTPILAANAVCTSQPLAAQAGLRMLAEGGNAVDAAIATAITLTLVEPVSNGIGSDAFAIVWDGQQLHGLNASGRSPAAWTPEYFCGKDVPILGWNSVTVPGAVSAWVDLHAKFGKLPFERLFGPAIAYGRNGFLVSPKVSAQWQAQVALFADQPGFAEAFLPGGRAPRPGELFTFPDHADTLEKIAASTGAAFYRGELADKLEAHARANDAALRASDLAAHRTDWVGTISTNYRDYTIHEIPPNGQGIVALIALGILDQFDMSCYPVDSADSVHLQIEALKLAFSDAQHQLADIDHMTVGPDQLLDKEYLRGRAALIDLKQAKPASAGTPKGGTIYLTAADADGLMVSMIQSNYMGFGSGVVVPGTGISLQNRGSGFVATPGHPNQVGPRKRPYHTIIPGFVTKDGAPVLSFGVMGAQMQPQGHVQMMVRIADYGQNPQAACDGPRFRWVQGLKVSCEKGFPPSTLDELRRRGHDLVTVEDYNEFGSCQAIWRLEHGYLAASDPRRDGQAAAF
Bibliography
No article yet recorded
