Gene Rv0773c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Besides the cephalosporin acylase I activity which converts GL-7ACA into 7-ACA; this enzyme displays some gamma glutamyltranspeptidase activity: GGT plays a key role in the gamma-glutamyl cycle, a pathway for the synthesis and degradation of glutathione. [catalytic activity 1: 7-beta-(4-carboxybutanamido)-cephalosporanic acid + H2O = 7-aminocephalosporanic acid + glutaric acid] [catalytic activity 2: (5-L-glutamyl)-peptide + an amino acid = peptide + 5-L-glutamyl-amino acid]. |
| Product | Probable bifunctional acylase GgtA: cephalosporin acylase (GL-7ACA acylase) + gamma-glutamyltranspeptidase (GGT) |
| Comments | Rv0773c, (MTCY369.18), len: 512 aa. Probable ggtA, bifunctional acylase including cephalosporin acylase, and gamma-glutamyl transpeptidase; highly similar to others e.g. NP_295247.1|NC_001263 cephalosporin acylase from Deinococcus radiodurans (535 aa); NP_248854.1|NC_002516 probable gamma-glutamyltranspeptidase from Pseudomonas aeruginosa (538 aa); P15557|PAC1_PSES3 acylase ACY 1 [includes: cephalosporin acylase (GL-7ACA acylase); gamma-glutamyltranspeptidase (GGT)] from Pseudomonas sp. strain SE83 (558 aa), FASTA scores: opt: 784, E(): 0, (34.2% identity in 526 aa overlap); NP_391491.1|NC_000964|Z93767|BSZ93767_6|O0521 protein similar to gamma-glutamyltransferase from Bacillus subtilis (525 aa), FASTA scores: opt: 1169, E(): 0, (40.1% identity in 516 aa overlap); etc. Also similar to Rv2394|ggtB from Mycobacterium tuberculosis. Member of GL-7ACA acylases and to GGT group. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 865851 | 867389 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0773c|ggtA
MPILATNVVCTSQPLAAQAGLRMLADGGNAVDAAVATAITLTVVEPVSNGIGSDAFSIVWDGQKLHGLNASGRSPSAWTPEYFGGNAVPVLGWNSVTVPGAVSAWVELHARFGRLPFETLFEPAISYGRNGFLVSPTVAAQWAAQVPLFASQPGFADAFMPGGRAPKPGELFTFPDHAATLEKIAATNGEEFYRGELAAKLEAHSAANGGVMRADDLAAHRVDWVDTITGTYRGYTIHQIPPNGQGIVALIALGILEHFDMSSWSVDSAESVHVQIEALKLAFADAQACVADIDYMPVHPKRLLDKEYLRQRATLIDPKRAMPAATGIPRGGTVYLAAADAAGMMVSMIQSNYLGFGSGVVVPGTGISLHNRGSDFTVVPRHPNRVGPRKRPYHTIIPGFVTRDGAPVMSFGVMGGMMQPQGHVQVLVRIADYGQNPQAACDGPRFRWVNGMRVSFENGFPDSTLDELRQRGHDLVAVADYSQFGSCQAIWRLDDGYLAASDPRRDGQAAAC
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
