Gene MMAR_5035
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | unknown; contains a FMN-binding split barrel domain. possible role in the electron-transfer pathway. the FMN-binding split barrel is related to the ferredoxin reductase-like FAD-binding domain. flavodoxins are an example of a group of proteins with a tightly bound flavin mononucleotide (FMN) that mediate electron transfer at low redox potential. |
| Product | conserved hypothetical protein |
| Comments | - |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 6110859 | 6111314 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_5035|MMAR_5035
MPKSPPRFLNSPFTDFFIKWMSRINTFMYRRNGGEGLGGTFQKIPVALLTTTGRKTGEPRVSPLYFHRDGDRVIVAASKGGSAKNPMWYLNLKANPKVGVQIKKEVLDLTARDATDEERARYWPKLVDMYPSYEDYQSWTDRTIPIVVCEP
Bibliography
No article yet recorded