Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown. Converts bicyclic nitroimidazole drug candidate pa-824 to three metabolites, generating NO.
ProductDeazaflavin-dependent nitroreductase Ddn
CommentsRv3547, (MTCY03C7.09c), len: 151 aa. Ddn, deazaflavin-dependent nitroreducatse (See Singh et al., 2008). Similar to hypothetical proteins e.g. O85698|3SCF60.07 from Streptomyces lividans and Streptomyces coelicolor (149 aa), FASTA scores: opt: 353, E(): 6.3e-17, (42.55% identity in 134 aa overlap); Q9WX21|SCE68.11 from Streptomyces coelicolor (305 aa) FASTA scores: opt: 290, E(): 2.1e-12, (38.5% identity in 122 aa overlap) (similarity in N-terminus for this protein); BAB52932|Q988L5|MLL6688 from Rhizobium loti (Mesorhizobium loti) (148 aa), FASTA scores: opt: 105, E(): 3, (26.75% identity in 86 aa overlap). Also similar to mycobacterial hypothetical proteins e.g. Q9ZH81 from Mycobacterium paratuberculosis (144 aa), FASTA scores: opt: 366, E(): 8.2e-18, (43.9% identity in 123 aa overlap); and Q10772|YF58_MYCTU|Rv1558|MT1609|MTCY48.07c from Mycobacterium tuberculosis (148 aa), FASTA scores: opt: 330, E(): 2.2e-15, (39.75% identity in 151 aa overlap); etc. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2DGE and MALDI-MS (See Sinha et al., 2002). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39868443987299+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3547|ddn
MPKSPPRFLNSPLSDFFIKWMSRINTWMYRRNDGEGLGGTFQKIPVALLTTTGRKTGQPRVNPLYFLRDGGRVIVAASKGGAEKNPMWYLNLKANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTDRTIPIVVCEP
      
Bibliography