Gene Rv3547
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown. Converts bicyclic nitroimidazole drug candidate pa-824 to three metabolites, generating NO. |
| Product | Deazaflavin-dependent nitroreductase Ddn |
| Comments | Rv3547, (MTCY03C7.09c), len: 151 aa. Ddn, deazaflavin-dependent nitroreducatse (See Singh et al., 2008). Similar to hypothetical proteins e.g. O85698|3SCF60.07 from Streptomyces lividans and Streptomyces coelicolor (149 aa), FASTA scores: opt: 353, E(): 6.3e-17, (42.55% identity in 134 aa overlap); Q9WX21|SCE68.11 from Streptomyces coelicolor (305 aa) FASTA scores: opt: 290, E(): 2.1e-12, (38.5% identity in 122 aa overlap) (similarity in N-terminus for this protein); BAB52932|Q988L5|MLL6688 from Rhizobium loti (Mesorhizobium loti) (148 aa), FASTA scores: opt: 105, E(): 3, (26.75% identity in 86 aa overlap). Also similar to mycobacterial hypothetical proteins e.g. Q9ZH81 from Mycobacterium paratuberculosis (144 aa), FASTA scores: opt: 366, E(): 8.2e-18, (43.9% identity in 123 aa overlap); and Q10772|YF58_MYCTU|Rv1558|MT1609|MTCY48.07c from Mycobacterium tuberculosis (148 aa), FASTA scores: opt: 330, E(): 2.2e-15, (39.75% identity in 151 aa overlap); etc. Predicted to be an outer membrane protein (See Song et al., 2008). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2DGE and MALDI-MS (See Sinha et al., 2002). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3986844 | 3987299 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3547|ddn
MPKSPPRFLNSPLSDFFIKWMSRINTWMYRRNDGEGLGGTFQKIPVALLTTTGRKTGQPRVNPLYFLRDGGRVIVAASKGGAEKNPMWYLNLKANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTDRTIPIVVCEP
Bibliography
- Sinha S et al. [2002]. Proteome analysis of the plasma membrane of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Singh R et al. [2008]. PA-824 kills nonreplicating Mycobacterium tuberculosis by intracellular NO release. Function Product
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant