Gene MMAR_5162
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | has both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. incises damaged DNA at cytosines, thymines and guanines. acts on a damaged strand (oxidized pyrimidines), 5' from the damaged site [catalytic activity: endonucleolytic cleavage near apurinic or apyrimidinic sites to products with 5'-phosphate]. |
| Product | endonuclease III Nth |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 6246887 | 6247669 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_5162|nth
VSGGSKPTANASTPKLPKRWSEETRTALVRRARRMNRKLAQAFPHVYCELDFTSPLELAVATILSAQSTDKRVNLTTPDLFVKYQTALDYAQADRAELENLIRPTGFYRNKANSLIGLGQALVERFDGQVPATMEELVTLPGVGRKTANVILGNAFDVPGITVDTHFGRLARRWRWTAEEDPVKVEHAVGELIERKEWTLLSHRVIFHGRRVCHARKPACGVCVLAKDCPSYGLGPTEPLLAAPLVQGPETEHLLAMAGL
Bibliography
No article yet recorded