Gene MMAR_5229
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | possible role in cell wall peptidoglycan biogenesis. contains Mur ligase family catalytic domain. possible UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase, required for the formation of the UDP-MurNAc-linked pentapeptide by addition of the D-Ala-D-Ala subgroup. |
| Product | UDP-N-acetylmuramyl tripeptide synthase |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 6319421 | 6320575 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_5229|MMAR_5229
MIGGLVAMTLDRSVLRQLASGRRTVVITGTNGKSTTTRMTAAALSTLGAVATNAEGANMDAGLVAALAADRRAGLAALEVDEMHVPHVSDAVEPAVLVLLNLSRDQLDRVGEINVIERTLRAGLARHPNAVVVANCDDVLMTSAAYDSPNVVWVAAGGSWSNDSVSCPRSGEVIVREPGHWYSTGADFKRPSPQWWFDDEAVYGPDGLALPMRLALPGAVNRGNATQAVAAAVALGADPALAVAAVAAVDEVAGRYRSFALGRHQARILLAKNPAGWQEALSMVDERAAGVVISVNGQVPDGEDLSWLWDVRFEHFAEAFKTTPVVAAGERGTDLAVRLGYAGVQHTLVHDTVAAIESCPPGPVEVVANYTAFLQLQRRLTRNG
Bibliography
No article yet recorded